Recombinant Full Length Human FUT7 Protein, GST-tagged

• Cat.No.: FUT7-5195HF
• Product Overview: Human FUT9 full-length ORF ( AAH36101.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 359 amino acids
• Description: The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X antigens. The encoded protein can direct the synthesis of the E-selectin-binding sialyl-Lewis X moiety. [provided by RefSeq
• Molecular Mass: 34.65 kDa
• AA Sequence: YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FUT7 fucosyltransferase 7 (alpha (1,3) fucosyltransferase) [ Homo sapiens ]
• Official Symbol: FUT7
• Synonyms: FUT7; fucosyltransferase 7 (alpha (1,3) fucosyltransferase); alpha-(1,3)-fucosyltransferase; fuc-TVII; fucosyltransferase VII; selectin ligand synthase; selectin-ligand synthase; galactoside 3-L-fucosyltransferase; FucT-VII
• Gene ID: 2529
• mRNA Refseq: NM_004479
• Protein Refseq: NP_004470
• MIM: 602030
• UniProt ID: Q11130