Recombinant Full Length Human FUNDC2 Protein, GST-tagged

• Cat.No.: FUNDC2-5138HF
• Product Overview: Human FUNDC2 full-length ORF (NP_076423.2, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 189 amino acids
• Description: FUNDC2 (FUN14 Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is FUNDC1.
• Molecular Mass: 47.1 kDa
• AA Sequence: METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLFGQESGPSAEKYSVATQLFIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHTGYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLLGMAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FUNDC2 FUN14 domain containing 2 [ Homo sapiens ]
• Official Symbol: FUNDC2
• Synonyms: FUNDC2; FUN14 domain containing 2; FUN14 domain-containing protein 2; DC44; HCBP6; HCC-3; cervical cancer oncogene 3; cervical cancer proto-oncogene 3 protein; hepatitis C virus core-binding protein 6; HCC3; PD03104; MGC2495; FLJ33773; MGC131676
• Gene ID: 65991
• mRNA Refseq: NM_023934
• Protein Refseq: NP_076423
• MIM: 301042
• UniProt ID: Q9BWH2