Recombinant Full Length Human FTH1 Protein, C-Flag-tagged

Specification
Gene Information
Related Products
Download

Description :	This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined.
Source :	Mammalian cells
Species :	Human
Tag :	Flag
Form :	25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass :	21 kDa
AA Sequence :	MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKL MKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLN EQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNESTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity :	> 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability :	Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage :	Store at -80 centigrade.
Concentration :	>50 ug/mL as determined by microplate BCA method.
Preparation :	Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families :	Druggable Genome
Protein Pathways :	Porphyrin and chlorophyll metabolism
Full Length :	Full L.

Gene Name	FTH1 ferritin heavy chain 1 [ Homo sapiens (human) ]
Official Symbol	FTH1
Synonyms	FHC; FTH; HFE5; PLIF; FTHL6; PIG15
Gene ID	2495
mRNA Refseq	NM_002032.3
Protein Refseq	NP_002023.2
MIM	134770
UniProt ID	P02794