Recombinant Full Length Human FSTL3 Protein, C-Flag-tagged
Cat.No. : | FSTL3-753HFL |
Product Overview : | Recombinant Full Length Human FSTL3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Follistatin-like 3 is a secreted glycoprotein of the follistatin-module-protein family. It may have a role in leukemogenesis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.9 kDa |
AA Sequence : | MRPGAPGPLWPLPWGALAWAVGFVSSMGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTA WSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGA TYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQEL CGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCAGTPEEPPGGESAEEEENFVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | FSTL3 follistatin like 3 [ Homo sapiens (human) ] |
Official Symbol | FSTL3 |
Synonyms | FLRG; FSRP |
Gene ID | 10272 |
mRNA Refseq | NM_005860.3 |
Protein Refseq | NP_005851.1 |
MIM | 605343 |
UniProt ID | O95633 |
◆ Recombinant Proteins | ||
FSTL3-5095HF | Recombinant Full Length Human FSTL3 Protein, GST-tagged | +Inquiry |
FSTL3-4527H | Recombinant Human FSTL3 Protein, GST-tagged | +Inquiry |
FSTL3-2664H | Recombinant Human FSTL3 Protein, MYC/DDK-tagged | +Inquiry |
FSTL3-940H | Recombinant Human FSTL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FSTL3-753HFL | Recombinant Full Length Human FSTL3 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FSTL3-2793MCL | Recombinant Mouse FSTL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FSTL3 Products
Required fields are marked with *
My Review for All FSTL3 Products
Required fields are marked with *
0
Inquiry Basket