Recombinant Full Length Human FRMD8 Protein, GST-tagged

• Cat.No.: FRMD8-4826HF
• Product Overview: Human FKSG44 full-length ORF ( NP_114110.1, 1 a.a. - 464 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FRMD8 (FERM Domain Containing 8) is a Protein Coding gene. An important paralog of this gene is KRIT1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 77.6 kDa
• Protein length: 464 amino acids
• AA Sequence: MDGTEGSAGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRAVREVLQLPDIALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVAMDEPFLQFRRNVFFPKRRELQIHDEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVCRVQLGPYQPGRPAACDLREKLDSFLPAHLCKRGQSLFAALRGRGARAGPGEQGLLNAYRQVQEVSSDGGCEAALGTHYRAYLLKCHELPFYGCAFFHGEVDKPAQGFLHRGGRKPVSVAISLEGVHVIDSREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVEDGKGIRRVKPKRTTSFFSRQLSLGQGSYTVVQPGDSLEQG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FRMD8 FERM domain containing 8 [ Homo sapiens ]
• Official Symbol: FRMD8
• Synonyms: FRMD8; FERM domain containing 8; FERM domain-containing protein 8; FKSG44; FLJ90369; FLJ32216; MGC31785
• Gene ID: 83786
• mRNA Refseq: NM_031904
• Protein Refseq: NP_114110
• MIM: 618337
• UniProt ID: Q9BZ67