Recombinant Full Length Human FOXJ1 Protein, GST-tagged

• Cat.No.: FOXJ1-5079HF
• Product Overview: Human FOXJ1 full-length ORF ( NP_001445.2, 1 a.a. - 421 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the forkhead family of transcription factors. Similar genes in zebrafish and mouse have been shown to regulate the transcription of genes that control the production of motile cilia. The mouse ortholog also functions in the determination of left-right asymmetry. Polymorphisms in this gene are associated with systemic lupus erythematosus and allergic rhinitis
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 71.6 kDa
• Protein length: 421 amino acids
• AA Sequence: MAESWLRLSGAGPAEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAPALPPGGTDPHGYHQVPGSAAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKGNFDWEAIFDAGTLGGELGALEALELSPPLSPASHVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXJ1 forkhead box J1 [ Homo sapiens ]
• Official Symbol: FOXJ1
• Synonyms: FOXJ1; forkhead box J1; FKHL13; forkhead box protein J1; HFH 4; HFH4; forkhead-like 13; fork head homologue 4; forkhead-related protein FKHL13; forkhead transcription factor HFH-4; hepatocyte nuclear factor 3 forkhead homolog 4; HFH-4; MGC35202
• Gene ID: 2302
• mRNA Refseq: NM_001454
• Protein Refseq: NP_001445
• MIM: 602291
• UniProt ID: Q92949