Recombinant Full Length Human FOXA1 Protein, GST-tagged
Cat.No. : | FOXA1-5044HF |
Product Overview : | Human FOXA1 full-length ORF ( NP_004487.2, 1 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 472 amino acids |
Description : | This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. [provided by RefSeq |
Molecular Mass : | 75.5 kDa |
AA Sequence : | MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOXA1 forkhead box A1 [ Homo sapiens ] |
Official Symbol | FOXA1 |
Synonyms | FOXA1; forkhead box A1; hepatocyte nuclear factor 3, alpha, HNF3A; hepatocyte nuclear factor 3-alpha; HNF-3A; TCF-3A; HNF-3-alpha; forkhead box protein A1; transcription factor 3A; hepatocyte nuclear factor 3, alpha; HNF3A; TCF3A; MGC33105; |
Gene ID | 3169 |
mRNA Refseq | NM_004496 |
Protein Refseq | NP_004487 |
MIM | 602294 |
UniProt ID | P55317 |
◆ Recombinant Proteins | ||
FOXA1-5044HF | Recombinant Full Length Human FOXA1 Protein, GST-tagged | +Inquiry |
FOXA1-5975M | Recombinant Mouse FOXA1 Protein | +Inquiry |
FOXA1-8876Z | Recombinant Zebrafish FOXA1 | +Inquiry |
FOXA1-319HFL | Recombinant Full Length Human FOXA1 Protein, C-Flag-tagged | +Inquiry |
FOXA1-02H | Recombinant Human FOXA1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXA1-6164HCL | Recombinant Human FOXA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOXA1 Products
Required fields are marked with *
My Review for All FOXA1 Products
Required fields are marked with *
0
Inquiry Basket