Recombinant Full Length Human FKBP14 Protein, GST-tagged

• Cat.No.: FKBP14-4792HF
• Product Overview: Human FKBP14 full-length ORF ( NP_060416.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the FK506-binding protein family of peptidyl-prolyl cis-trans isomerases. The encoded protein is found in the lumen of the endoplasmic reticulum, where it is thought to accelerate protein folding. Defects in this gene are a cause of a type of Ehlers-Danlos syndrome (EDS). Both a protein-coding variant and noncoding variants are transcribed from this gene. [provided by RefSeq, Mar 2012]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 50.6 kDa
• Protein length: 211 amino acids
• AA Sequence: MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FKBP14 FK506 binding protein 14, 22 kDa [ Homo sapiens ]
• Official Symbol: FKBP14
• Synonyms: FKBP14; FK506 binding protein 14, 22 kDa; FK506 binding protein 14 (22 kDa); peptidyl-prolyl cis-trans isomerase FKBP14; FKBP22; FLJ20731; FKBP-22; rotamase; 22 kDa FKBP; PPIase FKBP14; FK506-binding protein 14; 22 kDa FK506-binding protein; EDSKMH
• Gene ID: 55033
• mRNA Refseq: NM_017946
• Protein Refseq: NP_060416
• MIM: 614505
• UniProt ID: Q9NWM8