Recombinant Active Human FGF19 Protein, His-tagged(C-ter)

• Cat.No.: FGF19-75H
• Product Overview: Recombinant Active Human FGF19 Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This growth factor is a high affinity, heparin dependent ligand for FGFR4. Expression of this gene was detected only in fetal but not adult brain tissue. Synergistic interaction of the chick homolog and Wnt-8c has been shown to be required for initiation of inner ear development. [provided by RefSeq, Jul 2008]
• Source: E. coli
• Species: Human
• Tag: His
• Form: Powder
• Bio-activity: Determined by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 51 ng/mL.
• AA Sequence: MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 95% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 8.0)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: FGF19 fibroblast growth factor 19 [ Homo sapiens ]
• Official Symbol: FGF19
• Synonyms: FGF19; fibroblast growth factor 19; FGF-19
• Gene ID: 9965
• mRNA Refseq: NM_005117
• Protein Refseq: NP_005108
• MIM: 603891
• UniProt ID: O95750