Recombinant Active Human FGF19 Protein, His-tagged(C-ter)
Cat.No. : | FGF19-75H |
Product Overview : | Recombinant Active Human FGF19 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This growth factor is a high affinity, heparin dependent ligand for FGFR4. Expression of this gene was detected only in fetal but not adult brain tissue. Synergistic interaction of the chick homolog and Wnt-8c has been shown to be required for initiation of inner ear development. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 51 ng/mL. |
AA Sequence : | MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 95% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 8.0) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | FGF19 fibroblast growth factor 19 [ Homo sapiens ] |
Official Symbol | FGF19 |
Synonyms | FGF19; fibroblast growth factor 19; FGF-19; |
Gene ID | 9965 |
mRNA Refseq | NM_005117 |
Protein Refseq | NP_005108 |
MIM | 603891 |
UniProt ID | O95750 |
◆ Recombinant Proteins | ||
FGF19-75H | Recombinant Active Human FGF19 Protein, His-tagged(C-ter) | +Inquiry |
FGF19-2002Z | Recombinant Zebrafish FGF19 | +Inquiry |
FGF19-857HFL | Recombinant Full Length Human FGF19 Protein, C-Flag-tagged | +Inquiry |
FGF19-325H | Active Recombinant Human FGF19 Protein (Arg23-Lys216), C-His tagged, Animal-free, Carrier-free | +Inquiry |
FGF19-1485H | Recombinant Human FGF19 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF19-6244HCL | Recombinant Human FGF19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF19 Products
Required fields are marked with *
My Review for All FGF19 Products
Required fields are marked with *
0
Inquiry Basket