Recombinant Full Length Human FGF13 Protein, Flag-tagged

• Cat.No.: FGF13-3100HFL
• Product Overview: Recombinant Full Length Human FGF13 Protein, fused to Flag-tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag
• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked cognitive disability mapping to this region. Alternative splicing of this gene at the 5' end results in several transcript variants encoding different isoforms with different N-termini.
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol.
• Molecular Mass: 21.4 kDa
• AA Sequence: MALLRKSYSEPQLKGIVTKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTKLYL AMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIMKGNHVKKNKPAAH FLPKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade after receiving vials.
• Concentration: >0.05 µg/µL as determined by microplate Bradford method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Secreted Protein
• Protein Pathways: MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton
• Full Length: Full L.

Gene Information

• Gene Name: FGF13 fibroblast growth factor 13 [ Homo sapiens (human) ]
• Official Symbol: FGF13
• Synonyms: FGF2; FHF2; DEE90; FHF-2; FGF-13; XLID110; LINC00889
• Gene ID: 2258
• mRNA Refseq: NM_033642.3
• Protein Refseq: NP_378668.1
• MIM: 300070
• UniProt ID: Q92913