Recombinant Full Length Human FECH Protein, C-Flag-tagged
Cat.No. : | FECH-1762HFL |
Product Overview : | Recombinant Full Length Human FECH Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is localized to the mitochondrion, where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Mutations in this gene are associated with erythropoietic protoporphyria. Two transcript variants encoding different isoforms have been found for this gene. A pseudogene of this gene is found on chromosome 3. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 42.1 kDa |
AA Sequence : | MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQVQPQKRKPKTG ILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQG EGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYY NQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEV SATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDI EYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTS QQL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Porphyrin and chlorophyll metabolism |
Full Length : | Full L. |
Gene Name | FECH ferrochelatase [ Homo sapiens (human) ] |
Official Symbol | FECH |
Synonyms | EPP; FCE; EPP1 |
Gene ID | 2235 |
mRNA Refseq | NM_000140.5 |
Protein Refseq | NP_000131.2 |
MIM | 612386 |
UniProt ID | P22830 |
◆ Recombinant Proteins | ||
FECH-4065H | Recombinant Human FECH Protein, GST-tagged | +Inquiry |
FECH-1007H | Recombinant Human FECH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FECH-4535H | Recombinant Human FECH protein, His&Myc-tagged | +Inquiry |
FECH-9169Z | Recombinant Zebrafish FECH | +Inquiry |
FECH-1138H | Recombinant Human FECH | +Inquiry |
◆ Cell & Tissue Lysates | ||
FECH-6267HCL | Recombinant Human FECH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FECH Products
Required fields are marked with *
My Review for All FECH Products
Required fields are marked with *
0
Inquiry Basket