Recombinant Full Length Human FCF1 Protein, GST-tagged

• Cat.No.: FCF1-4734HF
• Product Overview: Human FCF1 full-length ORF (BAF83355.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FCF1 (FCF1 RRNA-Processing Protein) is a Protein Coding gene. Among its related pathways are rRNA processing in the nucleus and cytosol and Gene Expression. GO annotations related to this gene include poly(A) RNA binding.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 48.18 kDa
• Protein length: 198 amino acids
• AA Sequence: MGKQKKTRKYATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMPDDYGAPRF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FCF1 FCF1 small subunit (SSU) processome component homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: FCF1
• Synonyms: Bka; UTP24; CGI-35; C14orf111; FCF1 RRNA-Processing Protein; FCF1 Small Subunit (SSU) Processome Component Homolog (S. Cerevisiae); Chromosome 14 Open Reading Frame 111; RNA-Processing Protein FCF1 Homolog; FCF1 Small Subunit; CGI-35; UTP24; Bka
• Gene ID: 51077
• mRNA Refseq: NM_015962
• Protein Refseq: NP_057046
• UniProt ID: Q9Y324