Recombinant Full Length Human FBXO27 Protein, GST-tagged

• Cat.No.: FBXO27-5029HF
• Product Overview: Human FBXO27 full-length ORF ( NP_849142.1, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 283 amino acids
• Description: Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 58 kDa
• AA Sequence: MGASVSRGRAARVPAPEPEPEEALDLSQLPPELLLVVLSHVPPRTLLGRCRQVCRGWRALVDGQALWLLILARDHGATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCGQEGLRKWMVQHGGDGWVVEENRTTVPGAPSQTCFVTSFSWCCKKQVLDLEEEGLWPELLDSGRIEICVSDWWGARHDSGCMYRLLVQLLDANQTVLDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAGHYGARVTNSSVIVRVRLS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FBXO27 F-box protein 27 [ Homo sapiens ]
• Official Symbol: FBXO27
• Synonyms: FBXO27; F-box protein 27; F box only protein 27; F-box only protein 27; Fbg5; Fbx27; F-box protein FBG5; F-box/G-domain protein 5; FBG5
• Gene ID: 126433
• mRNA Refseq: NM_178820
• Protein Refseq: NP_849142
• MIM: 609099
• UniProt ID: Q8NI29