Recombinant Full Length Human FBXL2 Protein, C-Flag-tagged
Cat.No. : | FBXL2-961HFL |
Product Overview : | Recombinant Full Length Human FBXL2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains 12 tandem leucine-rich repeats. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.9 kDa |
AA Sequence : | MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNFQTDVEGRVVE NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSC VSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHEL VSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTL LARNCHELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDN CLLITDVALEHLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCC VILTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | FBXL2 F-box and leucine rich repeat protein 2 [ Homo sapiens (human) ] |
Official Symbol | FBXL2 |
Synonyms | FBL2; FBL3 |
Gene ID | 25827 |
mRNA Refseq | NM_012157.5 |
Protein Refseq | NP_036289.3 |
MIM | 605652 |
UniProt ID | Q9UKC9 |
◆ Recombinant Proteins | ||
Fbxl2-2962M | Recombinant Mouse Fbxl2 Protein, Myc/DDK-tagged | +Inquiry |
FBXL2-895H | Recombinant Human FBXL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXL2-3779H | Recombinant Human FBXL2 protein, His-tagged | +Inquiry |
FBXL2-2298H | Recombinant Human FBXL2 Protein (1-423 aa), His-tagged | +Inquiry |
FBXL2-10458Z | Recombinant Zebrafish FBXL2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBXL2 Products
Required fields are marked with *
My Review for All FBXL2 Products
Required fields are marked with *
0
Inquiry Basket