Recombinant Full Length Human FBLN7 Protein, GST-tagged

• Cat.No.: FBLN7-4895HF
• Product Overview: Human FBLN7 full-length ORF (BAC04416.1, 1 a.a. - 439 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FBLN7 (Fibulin 7) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding and heparin binding.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 73.8 kDa
• Protein length: 439 amino acids
• AA Sequence: MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKSRLAALQNSVGRVGPDALPVSCPALNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSMVCLPNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPECPEGSGNVSYVKTPPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FBLN7 fibulin 7 [ Homo sapiens ]
• Official Symbol: FBLN7
• Synonyms: TM14; FBLN7; fibulin 7; FBLN7; Fibulin 7; FIBL-7; TM14; Fibulin-7
• Gene ID: 129804
• mRNA Refseq: NM_153214
• Protein Refseq: NP_694946
• MIM: 611551
• UniProt ID: Q53RD9