Recombinant Full Length Human FATE1 Protein, GST-tagged

• Cat.No.: FATE1-4871HF
• Product Overview: Human FATE1 full-length ORF (BAB71454.1, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a cancer-testis antigen that is highly expressed in hepatocellular carcinomas and other tumors and weakly expressed in normal tissues except testis. The protein is strongly expressed in spermatogonia, primary spermatocytes, and Sertoli cells in seminiferous tubules. This protein may have a role in the control of early testicular differentiation and cell proliferation. [provided by RefSeq, Jan 2010]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 47.1 kDa
• Protein length: 183 amino acids
• AA Sequence: MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FATE1 fetal and adult testis expressed 1 [ Homo sapiens ]
• Official Symbol: FATE1
• Synonyms: FATE1; fetal and adult testis expressed 1; fetal and adult testis-expressed transcript protein; cancer/testis antigen 43; CT43; FATE; BJ-HCC-2 antigen; tumor antigen BJ-HCC-2; fetal and adult testis expressed transcript protein
• Gene ID: 89885
• mRNA Refseq: NM_033085
• Protein Refseq: NP_149076
• MIM: 300450
• UniProt ID: Q969F0