Recombinant Full Length Human FAM96A Protein, GST-tagged

• Cat.No.: FAM96A-4654HF
• Product Overview: Human FAM96A full-length ORF ( NP_115607.1, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FAM96A (Family With Sequence Similarity 96 Member A) is a Protein Coding gene. An important paralog of this gene is FAM96B.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 44.8 kDa
• Protein length: 160 amino acids
• AA Sequence: MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM96A family with sequence similarity 96, member A [ Homo sapiens ]
• Official Symbol: FAM96A
• Synonyms: FAM96A; family with sequence similarity 96, member A; Family With Sequence Similarity 96 Member A; Family With Sequence Similarity 96, Member A; MIP18 Family Protein FAM96A; CIA2A
• Gene ID: 84191
• mRNA Refseq: NM_032231
• Protein Refseq: NP_115607
• MIM: 618382
• UniProt ID: Q9H5X1