Recombinant Full Length Human FAM81A Protein, GST-tagged

• Cat.No.: FAM81A-4640HF
• Product Overview: Human FAM81A full-length ORF ( NP_689663.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 365 amino acids
• Description: FAM81A (Family With Sequence Similarity 81 Member A) is a Protein Coding gene. An important paralog of this gene is FAM81B.
• Molecular Mass: 68.4 kDa
• AA Sequence: MHLRRVRTMPRHSQSLTMAPYSSVSLVEQLEDRILCHEKTTAALVEHAFRIKDDIVNSLQKMQNKGGGDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKTLEMRQLSGLGDLRGRVARCDASIARLSAEHKTTYEGLQHLNKEQQAAKLILETKIKDAEGQISQLLNRVDLSISEQSTKLKMSHRDSNHQLQLLDTKFKGTVEELSNQILSARSWLQQEQERIEKELLQKIDQLSLIVKENSGASERDMEKKLSQMSARLDKIEEGQKKTFDGQRTRQEEEKMHGRITKLELQMNQNIKEMKAEVNAGFTAVYESIGSIRQVLEAKMKLDRDQLQKQIQLMQKPETPM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM81A family with sequence similarity 81, member A [ Homo sapiens ]
• Official Symbol: FAM81A
• Synonyms: FAM81A; family with sequence similarity 81, member A; protein FAM81A; MGC26690
• Gene ID: 145773
• mRNA Refseq: NM_152450
• Protein Refseq: NP_689663
• UniProt ID: Q8TBF8