Recombinant Full Length Human FAM45A Protein, GST-tagged

• Cat.No.: FAM45A-4686HF
• Product Overview: Human FAM45A full-length ORF ( NP_996892.1, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FAM45A (Family With Sequence Similarity 45 Member A) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 66.9 kDa
• Protein length: 357 amino acids
• AA Sequence: MAAAEVADTQLMLGVGLIEKDTNGEVLWVWCYPSTTATLRNLLLRKCCLTDENKLLHPFVFGQYRRTWFYITTIEVPDSSILKKVTHFSIVLTAKDFNPEKYAAFTRILCRMYLKHGSPVKMMESYIAVLTKGICQSEENGSFLSKDFDARKAYLAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEAVQEFTRTLPALVWHRQDWTILHSYVHLNADELEALQMCTGYVAGFVDLEVSNRPDLYDVFVNLAESEITIAPLAKEAMAMGKLHKEMGQLIVQSAEDPEKSESHVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKRFPPATENFLYHLAAAEQMLKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM45A family with sequence similarity 45, member A [ Homo sapiens ]
• Official Symbol: FAM45A
• Synonyms: FAM45A; family with sequence similarity 45, member A; Family With Sequence Similarity 45 Member A; Family With Sequence Similarity 45, Member A
• Gene ID: 404636
• mRNA Refseq: NM_207009
• Protein Refseq: NP_996892
• UniProt ID: Q8TCE6