Recombinant Full Length Human FAM45A Protein, GST-tagged

Cat.No. : FAM45A-4686HF
Product Overview : Human FAM45A full-length ORF ( NP_996892.1, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 357 amino acids
Description : FAM45A (Family With Sequence Similarity 45 Member A) is a Protein Coding gene.
Molecular Mass : 66.9 kDa
AA Sequence : MAAAEVADTQLMLGVGLIEKDTNGEVLWVWCYPSTTATLRNLLLRKCCLTDENKLLHPFVFGQYRRTWFYITTIEVPDSSILKKVTHFSIVLTAKDFNPEKYAAFTRILCRMYLKHGSPVKMMESYIAVLTKGICQSEENGSFLSKDFDARKAYLAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEAVQEFTRTLPALVWHRQDWTILHSYVHLNADELEALQMCTGYVAGFVDLEVSNRPDLYDVFVNLAESEITIAPLAKEAMAMGKLHKEMGQLIVQSAEDPEKSESHVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKRFPPATENFLYHLAAAEQMLKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM45A family with sequence similarity 45, member A [ Homo sapiens ]
Official Symbol FAM45A
Synonyms FAM45A; family with sequence similarity 45, member A; Family With Sequence Similarity 45 Member A; Family With Sequence Similarity 45, Member A
Gene ID 404636
mRNA Refseq NM_207009
Protein Refseq NP_996892
UniProt ID Q8TCE6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAM45A Products

Required fields are marked with *

My Review for All FAM45A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon