Recombinant Full Length Human FAM216B Protein, GST-tagged

• Cat.No.: FAM216B-4557HF
• Product Overview: Human FAM216B full-length ORF ( ADR82823.1, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 139 amino acids
• Description: FAM216B (Family With Sequence Similarity 216 Member B) is a Protein Coding gene.
• Molecular Mass: 15.3 kDa
• AA Sequence: MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGYITQREALSYALVLRDSTKRASAKVAPQRTIPRKTSAMTRRCPSVLPVSVVLPRAQSKRRQVLRN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM216B family with sequence similarity 216, member B [ Homo sapiens ]
• Official Symbol: FAM216B
• Synonyms: C13orf30; FAM216B; family with sequence similarity 216, member B; Family With Sequence Similarity 216 Member B; Family With Sequence Similarity 216, Member B; Chromosome 13 Open Reading Frame 30; Protein FAM216B
• Gene ID: 144809
• mRNA Refseq: NM_182508
• Protein Refseq: NP_872314
• UniProt ID: Q8N7L0