Recombinant Full Length Human FAM213B Protein, GST-tagged

• Cat.No.: FAM213B-4555HF
• Product Overview: Human FAM213B full-length ORF (BAG51845.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 216 amino acids
• Description: FAM213B (Family With Sequence Similarity 213 Member B) is a Protein Coding gene. Among its related pathways are Arachidonic acid metabolism and Metabolism. GO annotations related to this gene include oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor and prostaglandin-F synthase activity. An important paralog of this gene is FAM213A.
• Molecular Mass: 49.8 kDa
• AA Sequence: MSTVDLARVGACILKHAVTGEAVELRSLWREHACVVAGLRRFGCVVCRWIAQDLSSLAGLLDQHGVRLVGVGPEALGLQEFLDGDYFAGELYLDESKQLYKELGFKRLWTQASPEFGQATWCLRRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM213B family with sequence similarity 213, member B [ Homo sapiens ]
• Official Symbol: FAM213B
• Synonyms: C1orf93; FAM213B; family with sequence similarity 213, member B; Family With Sequence Similarity 213 Member B; rostamide/Prostaglandin F Synthase; Thioredoxin-Type PGF Synthase; Prostamide/PG F Synthase; Prostamide/PGF Synthase; Family With Sequence Similarity 213, Member B; Chromosome 1 Open Reading Frame 93; Protein FAM213B; EC 1.11.1.20
• Gene ID: 127281
• mRNA Refseq: NM_152371
• Protein Refseq: NP_689584
• UniProt ID: Q8TBF2