Recombinant Full Length Human FAM185A Protein, GST-tagged

• Cat.No.: FAM185A-4539HF
• Product Overview: Human FAM185A full-length ORF ( ABM84285.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 144 amino acids
• Description: FAM185A (Family With Sequence Similarity 185 Member A) is a Protein Coding gene.
• Molecular Mass: 42.24 kDa
• AA Sequence: MLAPCSGWELGCFRLCLRQVRLWAGAGRWACWACQARPYSSGGSERWPGSETEVPPPGPARRTLKEWTLQVSPFGRLRARLPCHLAVRPLDPLTYPDGDRVLVAVCGVEGGVRGLDGLQVKYDEDLEEMAIVSDTIHPQASVEV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM185A family with sequence similarity 185, member A [ Homo sapiens ]
• Official Symbol: FAM185A
• Synonyms: FAM185A; family with sequence similarity 185, member A; protein FAM185A; MGC35361
• Gene ID: 222234
• mRNA Refseq: NM_001145268
• Protein Refseq: NP_001138740
• UniProt ID: Q8N0U4