Recombinant Full Length Human FAM168A Protein, GST-tagged

• Cat.No.: FAM168A-4535HF
• Product Overview: Human FAM168A full-length ORF (BAF84743.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 235 amino acids
• Description: FAM168A (Family With Sequence Similarity 168 Member A) is a Protein Coding gene. Diseases associated with FAM168A include Tongue Cancer and Oral Squamous Cell Carcinoma. An important paralog of this gene is FAM168B.
• Molecular Mass: 52.25 kDa
• AA Sequence: MNPVYSPVQPGAPYGNPKNMAYTGYPTAYPAAAPAYNPSLYPTNSPSYAPATLLMKQAWPQNSSSCGTEGTFHLPVDTGTENRTYQASSAAFRYTAGTPYKVPPTQSNTAPPPYSPSPNPYQTAMYPIRSAYPQQNLYAQGAYYTQPVYAAQPHVIHHTTVVQPNSIPSAIYPAPVAAPRTNGVAMGMVAGTTMAMSAGTLLTTPQHTAIGAHPVSMPTYRAQGTPAYSYVPPHW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM168A family with sequence similarity 168, member A [ Homo sapiens ]
• Official Symbol: FAM168A
• Synonyms: FAM168A; family with sequence similarity 168, member A; KIAA0280; protein FAM168A; TCRP1; tongue cancer chemotherapy resistance associated protein 1; tongue cancer chemotherapy resistance-associated protein 1
• Gene ID: 23201
• mRNA Refseq: NM_015159
• Protein Refseq: NP_055974
• MIM: 616316
• UniProt ID: Q92567