Recombinant Full Length Human FAM13C1 Protein, GST-tagged

• Cat.No.: FAM13C1-4515HF
• Product Overview: Human FAM13C1 full-length ORF ( AAH36453.1, 1 a.a. - 585 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 585 amino acids
• Description: FAM13C (Family With Sequence Similarity 13 Member C) is a Protein Coding gene. An important paralog of this gene is FAM13A.
• Molecular Mass: 92.2 kDa
• AA Sequence: MFSCFCFSLQDNSFSSTTVTECDEDPVSLHEDQTDCSSLRDENNKENYPDAGALVEEHAPPSWEPQQQNVEATVLVDSVLRHSMGNFKSRKPKSIFKAESGRSHGESQETEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKDAFETRQDLNEEEAAQVHGVKDPAPASTQSVLADGTDSADPSPVHKDGQNEADSAPEDLHSVGTSRLLYHITDGDNPLLSPRCSIFSQSQRFNLDPESAPSPPSTQQFMMPRSSSRCSCGDGKEPQTITQLTKHIQSLKRKIRKFEEKFEQEKKYRPSHGDKTSNPEVLKWMNDLAKGRKQLKELKLKLSEEQGSAPKGPPRNLLCEQPTVPRENGKPEAAGPEPSSSGEETPDAALTCLKERREQLPPQEDSKVTKQDKNLIKPLYDRYRIIKQILSTPSLIPTIQEEEDSDEDRPQGSQQPSLADPASHLPVGDHLTYSNETEPVRALLPDEKKEVKPPALSMSNLHEATMPVLLDHLRETRADKKRLRKALREFEEQFFKQTGRSPQKEDRIPMADEYYEYKHIKAKLRLLEVLISKQDVAKTI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM13C family with sequence similarity 13 member C [ Homo sapiens (human) ]
• Official Symbol: FAM13C1
• Synonyms: Family With Sequence Similarity 13 Member C; Family With Sequence Similarity 13, Member C1; FAM13C1; Family With Sequence Similarity 13, Member C; Protein FAM13C; protein FAM13C; family with sequence similarity 13, member C1
• Gene ID: 220965
• mRNA Refseq: NM_001001971
• Protein Refseq: NP_001001971
• UniProt ID: Q8NE31