Recombinant Full Length Human FAM122C Protein, GST-tagged

• Cat.No.: FAM122C-4510HF
• Product Overview: Human FAM122C full-length ORF ( NP_620174.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FAM122C (Family With Sequence Similarity 122C) is a Protein Coding gene. An important paralog of this gene is FAM122A.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 43.5 kDa
• Protein length: 152 amino acids
• AA Sequence: MAQEKMKLGFKSLPSSTTADGNILRRVNSAPLINGLGFNSQVLQADMLRIRTNRTTFRNRRSLLLPPPPFHGSISRLHQIKQEEAMDLINRETMSEWKLQSEIQISHSWEEGLKLNDNGLQKSSSLKCIDLTPVSSMASSIKKTGKSTSSYF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM122C family with sequence similarity 122C [ Homo sapiens (human) ]
• Official Symbol: FAM122C
• Synonyms: FAM122C; family with sequence similarity 122C; Family With Sequence Similarity 122C; protein FAM122C
• Gene ID: 159091
• mRNA Refseq: NM_001170779
• Protein Refseq: NP_001164250
• UniProt ID: Q6P4D5