Recombinant Full Length Human FAM122B Protein, GST-tagged

• Cat.No.: FAM122B-4509HF
• Product Overview: Human FAM122B full-length ORF ( NP_660327.2, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 248 amino acids
• Description: FAM122B (Family With Sequence Similarity 122B) is a Protein Coding gene. An important paralog of this gene is FAM122A.
• Molecular Mass: 53.4 kDa
• AA Sequence: MAQEKMELDLEPDTSYGGTLRRSSSAPLIHGLSDLSQVFQPYTLRTRRNSTTIMSRHSLEEGLDMVNRETAHEREMQTAMQISQSWDESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGKMFVSSSGLPPSPVPSPRRFSSRRSQSPVKCIRPSVLGPLKRKGEMETESQPKRLFQGTTNMLSPDAAQLSDLSSCSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM122B family with sequence similarity 122B [ Homo sapiens ]
• Official Symbol: FAM122B
• Synonyms: FAM122B; family with sequence similarity 122B; protein FAM122B; DKFZp686L20116; RP11 308B5.5; synoviocyte proliferation associated in collagen-induced arthritis 2; SPACIA2; RP11-308B5.5; MGC131814
• Gene ID: 159090
• mRNA Refseq: NM_001166599
• Protein Refseq: NP_001160071
• UniProt ID: Q7Z309