Recombinant Full Length Human FAM117A Protein, GST-tagged

Cat.No. : FAM117A-4484HF
Product Overview : Human FAM117A full-length ORF ( NP_110429.1, 1 a.a. - 453 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 453 amino acids
Description : FAM117A (Family With Sequence Similarity 117 Member A) is a Protein Coding gene. An important paralog of this gene is GLCCI1.
Molecular Mass : 74.7 kDa
AA Sequence : MAGAAAGGRGGGAWGPGRGGAGGLRRGCSPPAPAGSPRAGLQPLRATIPFQLQQPHQRRDGGGRAASVPCSVAPEKSVCRPQPLQVRRTFSLDTILSSYLLGQWPRDADGAFTCCTNDKATQTPLSWQELEGERASSCAHKRSASWGSTDHRKEISKLKQQLQRTKLSRSGKEKERGSPLLGDHAVRGALRASPPSFPSGSPVLRLSPCLHRSLEGLNQELEEVFVKEQGEEELLRILDIPDGHRAPAPPQSGSCDHPLLLLEPGNLASSPSMSLASPQPCGLASHEEHRGAAEELASTPNDKASSPGHPAFLEDGSPSPVLAFAASPRPNHSYIFKREPPEGCEKVRVFEEATSPGPDLAFLTSCPDKNKVHFNPTGSAFCPVNLMKPLFPGMGFIFRNCPSNPGSPLPPASPRPPPRKDPEASKASPLPFEPWQRTPPSEEPVLFQSSLMV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM117A family with sequence similarity 117, member A [ Homo sapiens ]
Official Symbol FAM117A
Synonyms FAM117A; family with sequence similarity 117, member A; protein FAM117A; C/EBP induced protein; C/EBP-induced protein;
Gene ID 81558
mRNA Refseq NM_030802
Protein Refseq NP_110429
UniProt ID Q9C073

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAM117A Products

Required fields are marked with *

My Review for All FAM117A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon