Recombinant Full Length Human FAM109A Protein, GST-tagged

• Cat.No.: FAM109A-4465HF
• Product Overview: Human FAM109A full-length ORF ( NP_653272.2, 1 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein that localizes to the endosome and interacts with the enzyme, inositol polyphosphate 5-phosphatase OCRL-1. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 53.6 kDa
• Protein length: 249 amino acids
• AA Sequence: MKLNERSLAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVVRELEQQLAAVRGGGGMALPQPQPQSLPLPPSLPSALAPVPSLPSAPAPVPALPLPRRPSALPPKENGCAVWSTEATFRPGPEPPPPPPRRRASAPHGPLDMAPFARLHECYGQEIRALRGQWLSSRVQP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM109A family with sequence similarity 109, member A [ Homo sapiens ]
• Official Symbol: FAM109A
• Synonyms: FAM109A; family with sequence similarity 109, member A; sesquipedalian-1; FLJ32356; protein FAM109A; 27 kDa inositol polyphosphate phosphatase-interacting protein A; SES1; IPIP27A
• Gene ID: 144717
• mRNA Refseq: NM_001177996
• Protein Refseq: NP_001171467
• MIM: 614239
• UniProt ID: Q8N4B1