Recombinant Full Length Human FAM109A Protein, GST-tagged
Cat.No. : | FAM109A-4465HF |
Product Overview : | Human FAM109A full-length ORF ( NP_653272.2, 1 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a protein that localizes to the endosome and interacts with the enzyme, inositol polyphosphate 5-phosphatase OCRL-1. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
Source : | In Vitro Cell Free System |
Species : | Human |
Tag : | GST |
Molecular Mass : | 53.6 kDa |
Protein length : | 249 amino acids |
AA Sequence : | MKLNERSLAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVVRELEQQLAAVRGGGGMALPQPQPQSLPLPPSLPSALAPVPSLPSAPAPVPALPLPRRPSALPPKENGCAVWSTEATFRPGPEPPPPPPRRRASAPHGPLDMAPFARLHECYGQEIRALRGQWLSSRVQP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM109A family with sequence similarity 109, member A [ Homo sapiens ] |
Official Symbol | FAM109A |
Synonyms | FAM109A; family with sequence similarity 109, member A; sesquipedalian-1; FLJ32356; protein FAM109A; 27 kDa inositol polyphosphate phosphatase-interacting protein A; SES1; IPIP27A; |
Gene ID | 144717 |
mRNA Refseq | NM_001177996 |
Protein Refseq | NP_001171467 |
MIM | 614239 |
UniProt ID | Q8N4B1 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All FAM109A Products
Required fields are marked with *
My Review for All FAM109A Products
Required fields are marked with *
0
Inquiry Basket