Recombinant Full Length Human FAM104B Protein, GST-tagged

• Cat.No.: FAM104B-4454HF
• Product Overview: Human FAM104B full-length ORF (1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 115 amino acids
• Description: FAM104B (Family With Sequence Similarity 104 Member B) is a Protein Coding gene. An important paralog of this gene is FAM104A.
• Molecular Mass: 39.5 kDa
• AA Sequence: MGGCPVRKRRRSGSKEGNHHSTQPKRNKRNPIFQDSQDTEFSWSDNERSSSRINIPERASGPEGNLNQIVTEPDANFPQFLHEGLSKPVYVINWFMSFGPEIKLNTSQQGRNQAV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM104B family with sequence similarity 104, member B [ Homo sapiens ]
• Official Symbol: FAM104B
• Synonyms: FAM104B; family with sequence similarity 104, member B; chromosome X open reading frame 44 , CXorf44; protein FAM104B; FLJ20434; CXorf44; FLJ18375
• Gene ID: 90736
• mRNA Refseq: NM_001166699
• Protein Refseq: NP_001160171
• UniProt ID: Q5XKR9