Recombinant Full Length Human FADD Protein, GST-tagged
Cat.No. : | FADD-4435HF |
Product Overview : | Human FADD full-length ORF ( NP_003815.1, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 208 amino acids |
Description : | The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 49.7 kDa |
AA Sequence : | MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FADD Fas (TNFRSF6)-associated via death domain [ Homo sapiens ] |
Official Symbol | FADD |
Synonyms | FADD; Fas (TNFRSF6)-associated via death domain; protein FADD; Fas associating death domain containing protein; Fas associating protein with death domain; GIG3; growth inhibiting gene 3 protein; mediator of receptor induced toxicity; MORT1; growth-inhibiting gene 3 protein; mediator of receptor-induced toxicity; Fas-associating protein with death domain; Fas-associating death domain-containing protein; MGC8528; |
Gene ID | 8772 |
mRNA Refseq | NM_003824 |
Protein Refseq | NP_003815 |
MIM | 602457 |
UniProt ID | Q13158 |
◆ Cell & Tissue Lysates | ||
FADD-6473HCL | Recombinant Human FADD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FADD Products
Required fields are marked with *
My Review for All FADD Products
Required fields are marked with *
0
Inquiry Basket