Recombinant Full Length Human FABP5 Protein, GST-tagged

Cat.No. : FABP5-4424HF
Product Overview : Human FABP5 full-length ORF ( AAH19385, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 40.59 kDa
Protein length : 135 amino acids
AA Sequence : MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRITQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FABP5 fatty acid binding protein 5 (psoriasis-associated) [ Homo sapiens ]
Official Symbol FABP5
Synonyms FABP5; fatty acid binding protein 5 (psoriasis-associated); fatty acid-binding protein, epidermal; E FABP; KFABP; PA FABP; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog; EFABP; E-FABP; PAFABP; PA-FABP;
Gene ID 2171
mRNA Refseq NM_001444
Protein Refseq NP_001435
MIM 605168
UniProt ID Q01469

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FABP5 Products

Required fields are marked with *

My Review for All FABP5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon