Recombinant Full Length Human FABP1 Protein, GST-tagged

Cat.No. : FABP1-4420HF
Product Overview : Human FABP1 full-length ORF ( AAH32801, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 127 amino acids
Description : This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Mar 2011]
Molecular Mass : 39.71 kDa
AA Sequence : MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FABP1 fatty acid binding protein 1, liver [ Homo sapiens ]
Official Symbol FABP1
Synonyms FABP1; fatty acid binding protein 1, liver; fatty acid-binding protein, liver; L FABP; fatty acid-binding protein 1; liver-type fatty acid-binding protein; FABPL; L-FABP;
Gene ID 2168
mRNA Refseq NM_001443
Protein Refseq NP_001434
MIM 134650
UniProt ID P07148

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FABP1 Products

Required fields are marked with *

My Review for All FABP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon