Recombinant Full Length Human FABP1 Protein, GST-tagged

• Cat.No.: FABP1-4420HF
• Product Overview: Human FABP1 full-length ORF ( AAH32801, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Mar 2011]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 39.71 kDa
• Protein length: 127 amino acids
• AA Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FABP1 fatty acid binding protein 1, liver [ Homo sapiens ]
• Official Symbol: FABP1
• Synonyms: FABP1; fatty acid binding protein 1, liver; fatty acid-binding protein, liver; L FABP; fatty acid-binding protein 1; liver-type fatty acid-binding protein; FABPL; L-FABP
• Gene ID: 2168
• mRNA Refseq: NM_001443
• Protein Refseq: NP_001434
• MIM: 134650
• UniProt ID: P07148