Recombinant Full Length Human ETV3 Protein, GST-tagged

Cat.No. : ETV3-4367HF
Product Overview : Human ETV3 full-length ORF ( AAH22868, 1 a.a. - 143 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 143 amino acids
Description : ETV3 (ETS Variant 3) is a Protein Coding gene. Diseases associated with ETV3 include Subclavian Steal Syndrome. Among its related pathways are Macrophage Differentiation and Growth Inhibition by METS. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is ERF.
Molecular Mass : 41.47 kDa
AA Sequence : MKAGCSIVEKPEGGGGYQFPDWAYKTESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVMPNYPFINIRSSGKIQTLLVGN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ETV3 ets variant 3 [ Homo sapiens ]
Official Symbol ETV3
Synonyms ETV3; ets variant 3; ets variant gene 3 , ets variant gene 3, ETS family transcriptional repressor; ETS translocation variant 3; PE 1; ETS domain transcriptional repressor PE1; mitogenic Ets transcriptional suppressor; ets variant gene 3, ETS family transcriptional repressor; PE1; METS; PE-1; bA110J1.4; FLJ79173;
Gene ID 2117
mRNA Refseq NM_001145312
Protein Refseq NP_001138784
MIM 164873
UniProt ID P41162

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ETV3 Products

Required fields are marked with *

My Review for All ETV3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon