Recombinant Full Length Human ETV2 Protein, GST-tagged

• Cat.No.: ETV2-4366HF
• Product Overview: Human ETV2 full-length ORF ( AAI60032.1, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 342 amino acids
• Description: ETV2 (ETS Variant 2) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II core promoter proximal region sequence-specific DNA binding. An important paralog of this gene is ETS2.
• Molecular Mass: 64.02 kDa
• AA Sequence: MDLWNWDEASPQEVPPGNKLAGLEGAKLGFCFPDLALQGDTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSGDWTDMACTAWDSWSGASQTLGPAPLGPGPIPAAGSEGAAGQNCVPVAGEATSWSRAQAAGSNTSWDCSVGPDGDTYWGSGLGGEPRTDCTISWGGPAGPDCTTSWNPGLHAGGTTSLKRYQSSALTVCSEPSPQSDRASLARCPKTNHRGPIQLWQFLLELLHDGARSSCIRWTGNSREFQLCDPKEVARLWGERKRKPGMNYEKLSRGLRYYYRRDIVRKSGGRKYTYRFGGRVPSLAYPDCAGGGRGAETQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ETV2 ets variant 2 [ Homo sapiens ]
• Official Symbol: ETV2
• Synonyms: ETV2; ets variant 2; ets variant gene 2; ETS translocation variant 2; ER71; ets-related protein 71; ETSRP71; MGC129834; MGC129835
• Gene ID: 2116
• mRNA Refseq: NM_014209
• Protein Refseq: NP_055024
• MIM: 609358
• UniProt ID: O00321