Recombinant Full Length Human ESAM Protein, GST-tagged

Cat.No. : ESAM-4695HF
Product Overview : Human ESAM full-length ORF ( AAH16868, 1 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 390 amino acids
Description : ESAM (Endothelial Cell Adhesion Molecule) is a Protein Coding gene. Among its related pathways are Blood-Brain Barrier and Immune Cell Transmigration: VCAM-1/CD106 Signaling Pathways and Integrin Pathway. An important paralog of this gene is IGSF11.
Molecular Mass : 68.64 kDa
AA Sequence : MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ESAM endothelial cell adhesion molecule [ Homo sapiens ]
Official Symbol ESAM
Synonyms ESAM; endothelial cell adhesion molecule; endothelial cell-selective adhesion molecule; W117m; 2310008D05Rik; LP4791 protein; HUEL (C4orf1)-interacting protein;
Gene ID 90952
mRNA Refseq NM_138961
Protein Refseq NP_620411
MIM 614281
UniProt ID Q96AP7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ESAM Products

Required fields are marked with *

My Review for All ESAM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon