Recombinant Full Length Human ERH Protein, GST-tagged
Cat.No. : | ERH-4585HF |
Product Overview : | Human ERH full-length ORF ( AAH14301, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 104 amino acids |
Description : | ERH (Enhancer Of Rudimentary Homolog (Drosophila)) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding. |
Molecular Mass : | 37.18 kDa |
AA Sequence : | MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ERH enhancer of rudimentary homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | ERH |
Synonyms | ERH; enhancer of rudimentary homolog (Drosophila); enhancer of rudimentary (Drosophila) homolog; enhancer of rudimentary homolog; DROER; FLJ27340; |
Gene ID | 2079 |
mRNA Refseq | NM_004450 |
Protein Refseq | NP_004441 |
MIM | 601191 |
UniProt ID | P84090 |
◆ Recombinant Proteins | ||
ERH-28693TH | Recombinant Human ERH, His-tagged | +Inquiry |
ERH-3476H | Recombinant Human ERH Protein, GST-tagged | +Inquiry |
ERH-1317R | Recombinant Rhesus Macaque ERH Protein, His (Fc)-Avi-tagged | +Inquiry |
ERH-3439H | Recombinant Human ERH protein, His-tagged | +Inquiry |
ERH-4585HF | Recombinant Full Length Human ERH Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERH-6555HCL | Recombinant Human ERH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERH Products
Required fields are marked with *
My Review for All ERH Products
Required fields are marked with *
0
Inquiry Basket