Recombinant Full Length Human ERCC1 Protein, GST-tagged
Cat.No. : | ERCC1-4529HF |
Product Overview : | Human ERCC1 full-length ORF ( NP_973730.1, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 323 amino acids |
Description : | The product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer with the XPF endonuclease (also known as ERCC4), and the heterodimeric endonuclease catalyzes the 5' incision in the process of excising the DNA lesion. The heterodimeric endonuclease is also involved in recombinational DNA repair and in the repair of inter-strand crosslinks. Mutations in this gene result in cerebrooculofacioskeletal syndrome, and polymorphisms that alter expression of this gene may play a role in carcinogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. The last exon of this gene overlaps with the CD3e molecule, epsilon associated protein gene on the opposite strand. [provided by RefSeq, Oct 2009] |
Molecular Mass : | 62 kDa |
AA Sequence : | MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKVRALGKNPRSWGKERAPNKHNLRPQSFKVKKEPKTRHSGFRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ERCC1 excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) [ Homo sapiens ] |
Official Symbol | ERCC1 |
Synonyms | ERCC1; excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence); DNA excision repair protein ERCC-1; RAD10; UV20; COFS4; |
Gene ID | 2067 |
mRNA Refseq | NM_001166049 |
Protein Refseq | NP_001159521 |
MIM | 126380 |
UniProt ID | P07992 |
◆ Recombinant Proteins | ||
ERCC1-4665H | Recombinant Human ERCC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ERCC1-4529HF | Recombinant Full Length Human ERCC1 Protein, GST-tagged | +Inquiry |
ERCC1-2237H | Recombinant Human ERCC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ERCC1-5967Z | Recombinant Zebrafish ERCC1 | +Inquiry |
ERCC1-28691TH | Recombinant Human ERCC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERCC1-6568HCL | Recombinant Human ERCC1 293 Cell Lysate | +Inquiry |
ERCC1-6567HCL | Recombinant Human ERCC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERCC1 Products
Required fields are marked with *
My Review for All ERCC1 Products
Required fields are marked with *
0
Inquiry Basket