Recombinant Full Length Human EPB41L4B Protein, GST-tagged

• Cat.No.: EPB41L4B-4263HF
• Product Overview: Human EPB41L4B full-length ORF (BAA91133.1, 1 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 440 amino acids
• Description: EPB41L4B (Erythrocyte Membrane Protein Band 4.1 Like 4B) is a Protein Coding gene. Among its related pathways are Tight junction. GO annotations related to this gene include structural constituent of cytoskeleton and cytoskeletal protein binding. An important paralog of this gene is EPB41L5.
• Molecular Mass: 77.8 kDa
• AA Sequence: MKFLLIKDAPGKKKRKNLMLSFKRKHAKGQDLFDQIVYHLDLVETDYFGLQFLDSAQVAHWLDHAKPIKKQMKIGPAYALHFRVKYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFVFRLDSARTCKHLWKCAVEHHAFFRLRTPGNSKSNRSDFIRLGSRFRFSGRTEYQATHGSRLRRTSTFERKPSKRYPSRRHSTFKASNPVIAAQLCSKTNPEVHNYQPQYHPNIHPSQPRWHPHSPNVRPSFQDDRSHWKASASGDDSHFDYVHDQNQKNLGGMQSMMYRDKLMTAL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EPB41L4B erythrocyte membrane protein band 4.1 like 4B [ Homo sapiens ]
• Official Symbol: EPB41L4B
• Synonyms: EPB41L4B; erythrocyte membrane protein band 4.1 like 4B; band 4.1-like protein 4B; EHM2; FERM-containing protein CG1; CG1; FLJ21596; DKFZp761N1814
• Gene ID: 54566
• mRNA Refseq: NM_018424
• Protein Refseq: NP_060894
• MIM: 610340
• UniProt ID: Q9H329