Recombinant Full Length Human ENTPD1 Protein, C-Flag-tagged
Cat.No. : | ENTPD1-908HFL |
Product Overview : | Recombinant Full Length Human ENTPD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a plasma membrane protein that hydrolyzes extracellular ATP and ADP to AMP. Inhibition of this protein's activity may confer anticancer benefits. Several transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.8 kDa |
AA Sequence : | MEDTKESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHTSLYIYKWPAE KENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIPRSQHQETPVYLGATAGMRLLRME SEELADRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWITINYLLGKFSQKTRWFSIVPYETNNQETFG ALDLGGASTQVTFVPQNQTIESPDNALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVASNEILRD PCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFL PPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYIL SLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTYVFLMVLFSLVLFT VAIIGLLIFHKPSYFWKDMVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Purine metabolism, Pyrimidine metabolism |
Full Length : | Full L. |
Gene Name | ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1 [ Homo sapiens (human) ] |
Official Symbol | ENTPD1 |
Synonyms | CD39; SPG64; ATPDase; NTPDase-1 |
Gene ID | 953 |
mRNA Refseq | NM_001776.6 |
Protein Refseq | NP_001767.3 |
MIM | 601752 |
UniProt ID | P49961 |
◆ Recombinant Proteins | ||
Entpd1-1518M | Recombinant Mouse Entpd1 protein, His & T7-tagged | +Inquiry |
Entpd1-2210M | Active Recombinant Mouse Entpd1 protein, His-tagged | +Inquiry |
ENTPD1-1766R | Recombinant Rat ENTPD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENTPD1-27578TH | Recombinant Human ENTPD1 | +Inquiry |
ENTPD1-1102H | Recombinant Human ENTPD1 Protein (Met1-Tyr340), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENTPD1-431MCL | Recombinant Mouse ENTPD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENTPD1 Products
Required fields are marked with *
My Review for All ENTPD1 Products
Required fields are marked with *
0
Inquiry Basket