Recombinant Full Length Human ENAH Protein, GST-tagged

• Cat.No.: ENAH-4288HF
• Product Overview: Human ENAH full-length ORF (BAC04736.1, 1 a.a. - 467 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the enabled/ vasodilator-stimulated phosphoprotein. Members of this gene family are involved in actin-based motility. This protein is involved in regulating the assembly of actin filaments and modulates cell adhesion and motility. Alternate splice variants of this gene have been correlated with tumor invasiveness in certain tissues and these variants may serve as prognostic markers. A pseudogene of this gene is found on chromosome 3. [provided by RefSeq, Sep 2016]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 78.8 kDa
• Protein length: 467 amino acids
• AA Sequence: MMHALEVLNSQETGPTLPRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSVLGDSSASEPGLQAASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIGVNSASSKADTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTPEPTRKPWERTNTMNGSKSPVISRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ENAH enabled homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: ENAH
• Synonyms: ENAH; enabled homolog (Drosophila); protein enabled homolog; FLJ10773; MENA; NDPP1; ENA
• Gene ID: 55740
• mRNA Refseq: NM_001008493
• Protein Refseq: NP_001008493
• MIM: 609061
• UniProt ID: Q8N8S7