Recombinant Full Length Human ELSPBP1 Protein, GST-tagged

Cat.No. : ELSPBP1-4228HF
Product Overview : Human ELSPBP1 full-length ORF ( AAH15598, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 223 amino acids
Description : The protein encoded by this gene belongs to the sperm-coating protein family of epididymal origin. This protein and its canine homolog are the first known examples of proteins with four tandemly arranged fibronectin type 2 (Fn2) domains in the Fn2-module protein family. [provided by RefSeq, Jul 2008]
Molecular Mass : 50.27 kDa
AA Sequence : MTRWSSYLLGWTTFLLYSYESSGGMHEECVFPFTYKGSVYFTCTHIHSLSPWCATRAVYNGQWKYCQSEDYPRCIFPFIYRGKAYNSCISQGSFLGSLWCSVTSVFDEKQQWKFCETNEYGGNSLRKPCIFPSIYRNNVVSDCMEDESNKLWCPTTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNKGSKENLVWCATSYNYDQDHTWVYC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ELSPBP1 epididymal sperm binding protein 1 [ Homo sapiens ]
Official Symbol ELSPBP1
Synonyms E12; HE12; EDDM12
Gene ID 64100
mRNA Refseq NM_022142
Protein Refseq NP_071425
MIM 607443
UniProt ID Q96BH3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ELSPBP1 Products

Required fields are marked with *

My Review for All ELSPBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon