Recombinant Full Length Human EIF4EBP2 Protein, GST-tagged

• Cat.No.: EIF4EBP2-4294HF
• Product Overview: Human EIF4EBP2 full-length ORF ( AAH05057, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 120 amino acids
• Description: This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq, Oct 2008]
• Molecular Mass: 38.94 kDa
• AA Sequence: MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF4EBP2 eukaryotic translation initiation factor 4E binding protein 2 [ Homo sapiens ]
• Official Symbol: EIF4EBP2
• Synonyms: EIF4EBP2; eukaryotic translation initiation factor 4E binding protein 2; eukaryotic translation initiation factor 4E-binding protein 2; 4E-BP2; eIF4E-binding protein 2; phosphorylated, heat and acid stable regulated by insulin protein II; 4EBP2; PHASII
• Gene ID: 1979
• mRNA Refseq: NM_004096
• Protein Refseq: NP_004087
• MIM: 602224
• UniProt ID: Q13542