Recombinant Full Length Human EIF4EBP1 Protein, GST-tagged

Cat.No. : EIF4EBP1-4292HF
Product Overview : Human EIF4EBP1 full-length ORF ( AAH04459, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 118 amino acids
Description : This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation. [provided by RefSeq, Jul 2008]
Molecular Mass : 38.72 kDa
AA Sequence : MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF4EBP1 eukaryotic translation initiation factor 4E binding protein 1 [ Homo sapiens ]
Official Symbol EIF4EBP1
Synonyms EIF4EBP1; eukaryotic translation initiation factor 4E binding protein 1; eukaryotic translation initiation factor 4E-binding protein 1; 4E BP1; PHAS I; phosphorylated heat and acid stable protein regulated by insulin 1; eIF4E-binding protein 1; phosphorylated heat- and acid-stable protein regulated by insulin 1; BP-1; 4EBP1; 4E-BP1; PHAS-I; MGC4316;
Gene ID 1978
mRNA Refseq NM_004095
Protein Refseq NP_004086
MIM 602223
UniProt ID Q13541

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EIF4EBP1 Products

Required fields are marked with *

My Review for All EIF4EBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon