Recombinant Full Length Human EIF4E2 Protein, C-Flag-tagged

Cat.No. : EIF4E2-2032HFL
Product Overview : Recombinant Full Length Human EIF4E2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Enables ubiquitin protein ligase binding activity. Involved in positive regulation of miRNA mediated inhibition of translation. Acts upstream of or within negative regulation of translation. Located in P-body. Part of mRNA cap binding activity complex.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 28.2 kDa
AA Sequence : MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPG RPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLR KGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT IMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Transcription Factors
Protein Pathways : Insulin signaling pathway, mTOR signaling pathway
Full Length : Full L.
Gene Name EIF4E2 eukaryotic translation initiation factor 4E family member 2 [ Homo sapiens (human) ]
Official Symbol EIF4E2
Synonyms 4EHP; IF4e; 4E-LP; h4EHP; EIF4EL3
Gene ID 9470
mRNA Refseq NM_004846.4
Protein Refseq NP_004837.1
MIM 605895
UniProt ID O60573

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EIF4E2 Products

Required fields are marked with *

My Review for All EIF4E2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon