Recombinant Full Length Human EIF2S1 Protein, C-Flag-tagged

• Cat.No.: EIF2S1-262HFL
• Product Overview: Recombinant Full Length Human EIF2S1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The translation initiation factor EIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, EIF2, and GTP. EIF2 is composed of 3 nonidentical subunits, the 36-kD EIF2-alpha subunit (EIF2S1), the 38-kD EIF2-beta subunit, and the 52-kD EIF2-gamma subunit. The rate of formation of the ternary complex is modulated by the phosphorylation state of EIF2-alpha.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 35.9 kDa
• AA Sequence: MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNEC VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDD KYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKE ALRAGLNCSTENMPIKINLIAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTD
  TDETELARQMERLERENAEVDGDDDAEEMEAKAEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: EIF2S1 eukaryotic translation initiation factor 2 subunit alpha [ Homo sapiens (human) ]
• Official Symbol: EIF2S1
• Synonyms: EIF2; EIF-2; EIF2A; EIF-2A; EIF-2alpha
• Gene ID: 1965
• mRNA Refseq: NM_004094.5
• Protein Refseq: NP_004085.1
• MIM: 603907
• UniProt ID: P05198