Recombinant Full Length Human EIF1AY Protein, GST-tagged

• Cat.No.: EIF1AY-4405HF
• Product Overview: Human EIF1AY full-length ORF ( AAH05248, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is located on the non-recombining region of the Y chromosome. It encodes a protein related to eukaryotic translation initiation factor 1A (EIF1A), which may function in stabilizing the binding of the initiator Met-tRNA to 40S ribosomal subunits. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 41.47 kDa
• Protein length: 144 amino acids
• AA Sequence: MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF1AY eukaryotic translation initiation factor 1A, Y-linked [ Homo sapiens ]
• Official Symbol: EIF1AY
• Synonyms: EIF1AY; eukaryotic translation initiation factor 1A, Y-linked; eukaryotic translation initiation factor 1A, Y chromosome; eukaryotic translation initiation factor 1A, Y-chromosomal; eIF-4C; eIF-1A Y isoform; eukaryotic translation initiation factor 4C
• Gene ID: 9086
• mRNA Refseq: NM_004681
• Protein Refseq: NP_004672
• MIM: 400014
• UniProt ID: O14602