Recombinant Full Length Human EID1 Protein, GST-tagged

Cat.No. : EID1-2051HF
Product Overview : Human CRI1 full-length ORF ( NP_055150.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : EID1 (EP300 Interacting Inhibitor Of Differentiation 1) is a Protein Coding gene. GO annotations related to this gene include transcription corepressor activity and histone acetyltransferase regulator activity.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 47.3 kDa
Protein length : 187 amino acids
AA Sequence : MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EID1 EP300 interacting inhibitor of differentiation 1 [ Homo sapiens ]
Official Symbol EID1
Synonyms EID1; EP300 interacting inhibitor of differentiation 1; C15orf3, CREBBP/EP300 inhibitor 1 , CREBBP/EP300 inhibitory protein 1 , CRI1; EP300-interacting inhibitor of differentiation 1; EID 1; CREBBP/EP300 inhibitor 1; 21 kDa pRb-associated protein; NB4 apoptosis related protein; CREBBP/EP300 inhibitory protein 1; Rb- and p300-binding protein EID-1; E1A-like inhibitor of differentiation 1; retinoblastoma protein-associated protein; CRI1; EID-1; RBP21; PTD014; C15orf3; PNAS-22; IRO45620; MGC138883; MGC138884
Gene ID 23741
mRNA Refseq NM_014335
Protein Refseq NP_055150
MIM 605894
UniProt ID Q9Y6B2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EID1 Products

Required fields are marked with *

My Review for All EID1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon