Recombinant Full Length Human EID1 Protein, GST-tagged

• Cat.No.: EID1-2051HF
• Product Overview: Human CRI1 full-length ORF ( NP_055150.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: EID1 (EP300 Interacting Inhibitor Of Differentiation 1) is a Protein Coding gene. GO annotations related to this gene include transcription corepressor activity and histone acetyltransferase regulator activity.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 47.3 kDa
• Protein length: 187 amino acids
• AA Sequence: MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EID1 EP300 interacting inhibitor of differentiation 1 [ Homo sapiens ]
• Official Symbol: EID1
• Synonyms: EID1; EP300 interacting inhibitor of differentiation 1; C15orf3, CREBBP/EP300 inhibitor 1 , CREBBP/EP300 inhibitory protein 1 , CRI1; EP300-interacting inhibitor of differentiation 1; EID 1; CREBBP/EP300 inhibitor 1; 21 kDa pRb-associated protein; NB4 apoptosis related protein; CREBBP/EP300 inhibitory protein 1; Rb- and p300-binding protein EID-1; E1A-like inhibitor of differentiation 1; retinoblastoma protein-associated protein; CRI1; EID-1; RBP21; PTD014; C15orf3; PNAS-22; IRO45620; MGC138883; MGC138884
• Gene ID: 23741
• mRNA Refseq: NM_014335
• Protein Refseq: NP_055150
• MIM: 605894
• UniProt ID: Q9Y6B2