Recombinant Full Length Human EHF Protein, GST-tagged

Cat.No. : EHF-4323HF
Product Overview : Human EHF full-length ORF ( NP_036285.2, 1 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 300 amino acids
Description : This gene encodes a protein that belongs to an ETS transcription factor subfamily characterized by epithelial-specific expression (ESEs). The encoded protein acts as a transcriptional repressor and may be involved in epithelial differentiation and carcinogenesis. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011]
Molecular Mass : 61.3 kDa
AA Sequence : MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHTKKHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGVFRFLKSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EHF ets homologous factor [ Homo sapiens ]
Official Symbol EHF
Synonyms EHF; ets homologous factor; ETS homologous factor; epithelium specific ets factor 3; ESE3; ESE3 transcription factor; ESEJ; hEHF; ETS domain-containing transcription factor; epithelium-specific Ets transcription factor 3; ESE3B;
Gene ID 26298
mRNA Refseq NM_001206615
Protein Refseq NP_001193544
MIM 605439
UniProt ID Q9NZC4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EHF Products

Required fields are marked with *

My Review for All EHF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon