Recombinant Full Length Human EFNA3 Protein

• Cat.No.: EFNA3-140HF
• Product Overview: Recombinant full length Human Ephrin A3 with N terminal proprietary tag; Predicted MWt 51.92 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 238 amino acids
• Description: This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin.
• Form: Liquid
• Molecular Mass: 51.920kDa inclusive of tags
• AA Sequence: MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSS NQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPG GGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPI KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLR MKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEG ENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: EFNA3 ephrin-A3 [ Homo sapiens ]
• Official Symbol: EFNA3
• Synonyms: EFNA3; ephrin-A3; EPLG3; Ehk1 L; LERK3
• Gene ID: 1944
• mRNA Refseq: NM_004952
• Protein Refseq: NP_004943
• MIM: 601381
• UniProt ID: P52797