Recombinant Full Length Human EFHC2 Protein, GST-tagged
Cat.No. : | EFHC2-4212HF |
Product Overview : | Human EFHC2 full-length ORF ( NP_079460.2, 1 a.a. - 749 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 749 amino acids |
Description : | This gene encodes a protein which contains three DM10 domains and three calcium-binding EF-hand motifs. A related protein is encoded by a gene on chromosome 6. It has been suggested that both proteins are involved in the development of epilepsy (PMID: 15258581, 16112844) and that this gene may be associated with fear recognition in individuals with Turner syndrome. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 113.8 kDa |
AA Sequence : | MALPLLPGNSFNRNVGKEKFHKSQHWGFCNNVMMLVSDEKPGIGGEPLLGQKIKPKCSIYPKGDGSDVPSWVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPEVKNSGLLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKIGVKVNPPVQCPEDPYMKIRREVVEHVEPLRPYESLDTLKQFLQYHGKILCFFCLWDDSVSMFGDRRELILHYFLCDDTIEIKELLPHSSGRDALKMFLRRSKLPKNCPPRVYQPGQITDRAVLNSYGDFIKNQADGYLFDRYKLGKVDQEFYKDSDLSLGVTINVWGRKVLLYDCDEFTKSYYKSKYGIENFTSVSCKPPSPPPKIERKFPPYNGFGSEEDSLRNCIDLKPTPHRRNFKKFMEKDSYGSKSNILRFFAKLVTDKCVDLDRMFVISYYLGDDTISVFEPIERNSGIAGGMFLKRSRVKKPGQEVFKSELSEYIKAEELYIGVTVNVNGYLFRLLNADEYTLNYMEQNTDKYPFSNLKLALQKLKQEEGKSRELKQVFKAADSKHTNMVDYNTFRDILMSLTVGNLAEQEFVTIARHYRVPEGTCSDMDFLIALAHEKFKKNMFENFDTFIYSCVYEDREKKNVLPTKDIKRLCKSSRLPLSDDLLESLLSRFEDSEKQIDYKSFFSALNWRKNPVPELQPASYLKERCEDVWLGMPSPIPAKYIDYWTFLKDAFGLEEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EFHC2 EF-hand domain (C-terminal) containing 2 [ Homo sapiens ] |
Official Symbol | EFHC2 |
Synonyms | EFHC2; EF-hand domain (C-terminal) containing 2; EF-hand domain-containing family member C2; FLJ22843; dJ1158H2.1; FLJ22601; DKFZp686G08235; |
Gene ID | 80258 |
mRNA Refseq | NM_025184 |
Protein Refseq | NP_079460 |
MIM | 300817 |
UniProt ID | Q5JST6 |
◆ Recombinant Proteins | ||
EFHC2-3520Z | Recombinant Zebrafish EFHC2 | +Inquiry |
EFHC2-4212HF | Recombinant Full Length Human EFHC2 Protein, GST-tagged | +Inquiry |
EFHC2-3298C | Recombinant Chicken EFHC2 | +Inquiry |
EFHC2-3092H | Recombinant Human EFHC2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFHC2-535HCL | Recombinant Human EFHC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EFHC2 Products
Required fields are marked with *
My Review for All EFHC2 Products
Required fields are marked with *
0
Inquiry Basket